PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 324aa    MW: 37180.7 Da    PI: 5.0791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227905.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.32.1e-2181403128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkk....leleevikevd.iykvePwdLpkkvka...eekewyfFskrdkkyatgkrknr.atksgyWkatgk 88 
                      GfrF+Ptd+el++++L kk  +k+       +++++e++ + ++ePw    ++ +    ++++yfF++ ++ +++gkr +r + + g+W++t +
  XP_008227905.1   8 LGFRFRPTDQELISYFLYKKSITKDplmaSYYSNIVHEFNfLGETEPWVVWDQFGGpglVDEDLYFFTELKNLSQKGKRIKRkIEAGGTWRETFS 102
                     6******************98877767643334579999736799*****74443333367899******************5555899****99 PP

             NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +k   +++g+ +g k+ L + +  +    + +W+++ey+l
  XP_008227905.1 103 KKVYNKTTGNPIGQKRNLRYEN--QGCEDHGKWLLEEYSL 140
                     7766666999*********984..3444589*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-205155IPR003441NAC domain
PROSITE profilePS5100526.876156IPR003441NAC domain
PfamPF023655.5E-169140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MANNNRLLGF RFRPTDQELI SYFLYKKSIT KDPLMASYYS NIVHEFNFLG ETEPWVVWDQ  60
FGGPGLVDED LYFFTELKNL SQKGKRIKRK IEAGGTWRET FSKKVYNKTT GNPIGQKRNL  120
RYENQGCEDH GKWLLEEYSL LDKEAQKIVL CRLKKNGRVS NKRNNSTQEF KEKPSNKKAR  180
KELASATVKI DDEQPQRSSS LSSVVNNHDQ ELIFDINYNA ISNYLCGDDQ DNIDDPFDYG  240
CLTDEEYAID MDALLGAPPL SQELPHIDET LRALDALLDV SSSSLDSPVV VLARFLQDVN  300
SVRESEEEAV SRRFFASETR LKMG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227905.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5W3I11e-109M5W3I1_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12591634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-12NAC domain containing protein 83